Tyrent love yuwu @Tyrent@bugs.social
- Header by
- https://www.patreon.com/ruskjoel
- About/links
- https://profile.bugs.social
- Game Servers
- http://tyrentgameservers.com/
Admin
Australian, gamer and collector of fetishes.
GMT+8
Joined Jul 2018
le sigh.
Guess I should sleep 
Tyrent love yuwu
boosted
Tyrent love yuwu
boosted
@Anzeliane I love your hair~ 
Fun fact: I can't tilt my head to far back for too long due an extra bone in my neck that can cause me to go unconscious.
Yoooo!
Got the cubeworld server connected on the domain. no longer need to remember the IP
Think I might stream tomorrow. Been busy all day today and haven't been able to play any games. Plus my net kept dropping out...
@debugninja Yoo! Congrats! Happy birthday :D
@Sir_Boops I'm happy it only cracked. The kitty could have been hurt :(
@Sir_Boops thats so mean! D:
Tyrent love yuwu
boosted
@BestGirlGrace You don't like the idea of a futa maid? D:
Tyrent love yuwu
boosted
agfykvfjghfkffgsgsgskkgkskwwykwykwtksmgmvmzvmzzgmgskyeylyylyggssylwlwlywylwykwylgwkgwkgsktkgsmggzmgzmgmgmzmgsmgsmgsmgslywlywlwlwpowqwqtkskykgsmggmsmgslywktwtkskggzmgzgmgssmgzmgzvmzmzgmmgsglslyyeylgsgzgzmvzcmFnFnFnafnsfmsmfsmfgzmgzgmzvmvhdlydeluelyyeshmssgmmsggm
Mvxghggggggggslgslslslgsgssgzghxxchcncjcjfhhsgksktatkatkaktamffmagsgzhxhxhxgmgsmgsmggzmzmgzkggkgsgkskwtkwkktaafkafkqqjtjrqjrqqrjqrjjrqafjajfafjajfafjakffkagkstktksktsgzhxcccgmggmsgmzmzgmzgmmggmgmgmzmggmzgmslgskskgaqwkdhfffugjggggcfxgffdgf
gun mention shitpost Show more
Tyrent love yuwu
boosted
gun mention shitpost Show more
@fortune I'm clicking and no bobs are appearing!!! REEEEEEEEEEEEE
Tyrent love yuwu
boosted
Today's spam:
Huge Real Boobs
They're huge. They're firm.
Ride the Titty Express.
Cover her peaks with your cum.
Click Here To Get It
Huge Real Boobs
They're huge. They're firm.
Ride the Titty Express.
Cover her peaks with your cum.
Click Here To Get It
Trying to grab plastic cause my cat is eating it and instead of biting me or something she just stands like a statue and blocks my arm.
She is built like a truck > : O
- Header by
- https://www.patreon.com/ruskjoel
- About/links
- https://profile.bugs.social
- Game Servers
- http://tyrentgameservers.com/
Admin
Australian, gamer and collector of fetishes.
GMT+8
Joined Jul 2018
